- Semaphorin 4G Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82171
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Semaphorin 4G
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: ATPRMTIPYE ELSGTRHFKG QAQNYSTLLL EEASARLLVG ARGALFSLSA NDIGDGAHKE IHWEASPEMQ SKCH
- Human
- Rabbit
- semaphorin 4G
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Neuroscience
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH
Specifications/Features
Available conjugates: Unconjugated